Sign In | Join Free | My frozenstories.com
frozenstories.com
Products
Search by Category
Home > Chemicals > Inorganic Acid >

Fat Burning Peptide

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    fat burning peptide

    All fat burning peptide wholesalers & fat burning peptide manufacturers come from members. We doesn't provide fat burning peptide products or service, please contact them directly and verify their companies info carefully.

    Total 2576 products from fat burning peptide Manufactures & Suppliers
    Buy cheap  product

    Brand Name:HongKong Blue Universal Co., Limited.

    Model Number:51753-57-2

    Place of Origin:China

    Releasing Hormone Peptides Cjc - 1295 With Dac Polypeptides For Fat Burning 1.Quick Details: Contact info. ---skype: mabel_3566;Email : mabel@sinosteroids.comProduct Name---Cjc - 1...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Buy cheap  product

    Brand Name:LSW

    Model Number:87616-84-0

    Place of Origin:China

    ...Fat Burning Peptides Drug Human Growth Hormone Somatropin GHRP-6 CAS 87616-84-0 Description: GHRP-6 (Growth Hormone Releasing Peptide -6) is a synthetic, growth hormone releasin...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hong Kong

    Buy cheap  product

    Brand Name:Biopro

    Model Number:GHP-30

    Place of Origin:China

    ... Hormone Releasing Peptide , Fat Burning Peptides Bodybuilding AOD 9604 AOD9604 is based on a small part of the human growth hormone molecule. This hormone, which occurs natural...

    Biopro Chemicals Co., Ltd.
    Verified Supplier

    Shanghai

    Buy cheap  product

    Brand Name:Gongchuang

    Model Number:steroid raw

    Place of Origin:China

    ...Follistatin 344 Peptides Steroids Follistatin-315 Fat Burning Peptide For Bodybuildier​ Follistatin is fascinating protein that can increase muscle mass beyond natural potential...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Buy cheap  product

    Brand Name:Nanjian

    Model Number:221231-10-3

    Place of Origin:China

    ...Fat burning Peptide steroids powder AOD - 9604 Lyophilized HGH Fragment 177-191 98% CAS: 221231-10-3 for muscle ......

    Tai'an Jia Ye Biological Technology Co.,Ltd
    Verified Supplier

    Buy cheap  product

    Brand Name:Biofriend

    Model Number:140703-51-1

    Place of Origin:Wuhan

    ...Hexarelin Examorelin Fat Burning Peptides , Human Growth Hormone Peptide for Weight Loss Quick Details: * Product name: Hexarelin/ Examorelin * Synonyms: L-lysinamide, L-histidy...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:JCJ

    Model Number:Cas No.: 79561-22-1

    Place of Origin:China

    ...): 98%min. Appearance : White powder Single Impurity(HPLC): 1.0%max Amino Acid Composition: ±10% of theoretical Peptide Content(N%): ≥80.0% Water Content(Karl Fischer): ≤8.0% Ac...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:wumeitech

    Model Number:Follistatin 344

    Place of Origin:China

    ...Body Fat Burning Peptide Powders For Sexual Follistatin 344 Polypeptides Follistatin-315 Product Name:Follistatin 344 Follistatin 344 Alias:......

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:HUAO

    Model Number:863288-34-0

    Place of Origin:China

    ...2mg Vial CJC - 1295 Human Growth Peptides , Fat Burning Peptides CAS 863288 - 34 - 0 Core Tip:CJC-1295 DAC and CJC-1295 are both Growth Hormone ......

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:JNJG

    Model Number:22123265

    Place of Origin:CHINA

    ...White Powder Adipotide Fat Burning Peptides 2mg / Vial For Weight Loss , 99% Assay Adipotide Quick Detail: Product Name: Adipotide Adipotide Molecular ......

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier

    Shandong

    Buy cheap  product

    Brand Name:Sendi

    Model Number:221231-10-3

    Place of Origin:China

    ...Safe shipping from china Peptides Steroids Powder HGH Fragment 176-191 2mg Per Vial Quick Detail: HGH fragment 176-191 ......

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:JNJG

    Model Number:140703-51-1

    Place of Origin:CHINA

    ...Guarantee Quality Peptides Hexarelin Acetate 2mg 140703-51-1 for Fat Burning Hexarelin Specification: Product Name Hexarelin Hexarelin Alias Hexarelin Acetate Hexarelin CAS 1407...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Buy cheap  product

    Brand Name:Kafen

    Model Number:qualified

    Place of Origin:Guangdong

    ...Rebuild Body Tissue Fat Burning Peptides 5 Mg / Vial Selank To Lose Stubborn Fat 1 . Quick Details: Product Name:Selank Sequence: Thr-Lys-PRO-Arg-PRO-Gly-PRO Purity: 99% ......

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:Pharmagrade Steroids

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:owen.steroid

    Model Number:Lyophilized Powder In Vials / Pure Raw Powder No Vial

    Place of Origin:China

    ...Pharmaceutical Lean Muscle Fat Burning Peptides Hgh Fragment 176 191 5mg 2mg 10mg​ Product Details: Product Name HGH Fragment 176-191 ......

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:YIHAN

    Model Number:Hexarelin

    Place of Origin:China

    ...Hexarelin Human Growth Hormone For Weight Loss , Fat Burning Peptides CAS 140703-51-1 Quick detail : Product name : Hexarelin Synonyms : HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;......

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Buy cheap  product

    Brand Name:nanjian

    Model Number:2mg/Vial

    Place of Origin:China

    ...fat Loss Powder Peptide China supplier Cjc-1295 DAC CJC-1295 DAC has shown some amazing results as a hormone ......

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Buy cheap  product

    Brand Name:YUANYANG

    Model Number:CAS: 170851-70-4

    Place of Origin:CHINA

    ...-4 MF: C38H49N9O5 MW: 711.85296 Appearance: White Lyophilized Powder Method of Analysis: HPLC Storage: Lyophilized peptides although stable at room temperature for 3 months, sho...

    Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Model Number:99%

    Place of Origin:China

    ... half-life extended to 8 days. This is convenient as it means the product only needs peptide injection once or twice per week for continuously elevated levels of HGH and IGF-1. ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    Buy cheap  product

    Brand Name:www.steroidaily.com

    Model Number:221231-10-3

    Place of Origin:China

    ...2mg/Vial Fat Burning Peptide HGH Fragment 176-191 for Muscle Growthing Fragments 176-191 details: Name: 176-191 CAS: ......

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Buy cheap  product

    Brand Name:Bodybuilding

    Model Number:57773-63-4

    Place of Origin:China

    ...2mg/Vial Fat Burning Peptide H-GH Fragments 176-191 for Weight Loss Pass Custom Safely Safely Pass Customs Safely Pass ......

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Inquiry Cart 0